Home Research Services Publications People Teaching Job Opening News Lab Only
Online Services

●I-TASSER ●QUARK ●LOMETS ●COACH ●COFACTOR ●MUSTER ●SEGMER ●FG-MD ●ModRefiner ●REMO ●SPRING ●COTH ●BSpred ●SVMSEQ ●ANGLOR ●BSP-SLIM ●SAXSTER ●ThreaDom ●EvoDesign ●GPCR-I-TASSER ●BindProf ●BindProfX ●ResQ ●IonCom ●STRUM

●TM-score ●TM-align ●MMalign ●NWalign ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●I-TASSER-MR

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●TM-fold ●DECOYS ●POTENTIAL ●RW ●HPSF ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12

          [Home] [Forum] [Example in Benchmark Mode] [Help]
Sequence Information of T2297kq8l(your_protein)     
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS
NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR

The Input Parameters
Unit cell (a,b,c):(79.6160,79.6160,137.5500)
Unit cell (α,β,γ):(90.0000,90.0000,120.0000)
Space Group:P 65 2 2
Copy Number:1
Lowest Resolution:68.949
Highest Resolution:1.950
mtz file:Download

Best Models with the lowest R-free
MR Model    Refined Model
  
MR-T2297kq8l-1-M1     R_free=0.4758    Refine-T2297kq8l-1-M1     R_free=0.3553


I-TASSER-MR Results of Sequence T2297kq8l
I-TASSER
Models		I-TASSER-MR Models
Model1
Search ModelMR ModelRefined ModelStarting RworkFinal RworkStarting RfreeFinal Rfree
Search-T2297kq8l-1-M1   MR-T2297kq8l-1-M1   Refine-T2297kq8l-1-M1   0.4623   0.3330   0.4758   0.3553  
Search-T2297kq8l-2-M1   MR-T2297kq8l-2-M1   Refine-T2297kq8l-2-M1   0.4620   0.3326   0.4752   0.3589  
Search-T2297kq8l-3-M1   MR-T2297kq8l-3-M1   Refine-T2297kq8l-3-M1   0.4615   0.3327   0.4755   0.3598  
Search-T2297kq8l-4-M1   MR-T2297kq8l-4-M1   Refine-T2297kq8l-4-M1   0.4618   0.3378   0.4726   0.3644  
Search-T2297kq8l-5-M1   MR-T2297kq8l-5-M1   Refine-T2297kq8l-5-M1   0.4614   0.3315   0.4712   0.3648  
  • I-TASSER Models:the models predicted by I-TASSER;
  • I-TASSER-MR Models: top 5 search models, MR models and refined models ranked by the final Rfreee of the refined models;
  • Search Model: top 5 search models edited by progressive model truncation;
  • MR Model: top 5 models produced by MR-REX from the corresponding top 5 search models;
  • Starting Rwork: the starting Rwork of the refined models;
  • Final Rwork: the final Rwork of the refined models;
  • Starting Rfree: the starting Rfree of the refined models;
  • Final Rfree: the final Rfree of the refined models.

I-TASSER Search Models for Sequence T2297kq8l
I-TASSER
Models		Distribution of the AVS-scoreDownload
Model1
cscore:0.84		 Download
  • I-TASSER Models: the models predicted by I-TASSER;
  • Download: the dowload file includes the AVS score file and all the edited search models;

Top 10 templates used by I-TASSER for Sequence T2297kq8l
RankTemplateAligned LengthCoverageZ-scoreProgramAlignments
13daiA1301.00020.598MUSTERDownload
25epb_A1290.99219.351HHpred_localDownload
35e74a1130.86919.383SP3Download
43daiA1301.0008.315PROSPECT2Download
53daiA1301.00041.312PPA-IDownload
65epb_A1301.00017.790HHpred_globalDownload
74nr9a1130.86918.539SPARKS2Download
82dkwA1250.96217.643MUSTERDownload
92dkw_A1240.95417.755HHpred_localDownload
104nr9a1130.86919.352SP3Download
  • Rank of templates: represents the top ten threading templates used by I-TASSER;
  • Aligned length: the number of aligned residues;
  • Coverage: it represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein;
  • Z-score: Z-score is the normalized Z-score of the threading alignment;
  • Download Alignments: Provides the 3D structure of the aligned regions of the threading templates.
Download
All the result files shown in the page can be downloaded as a tarball package.

References:
  • Y. Wang, J. Virtanen, Z. Xue, Y. Zhang. I-TASSER-MR: automated molecular replacement for proteins without close homologs using iterative fragment assembly and progressive sequence truncation, submitted (2017).
  • Y. Wang, J. Virtanen, Z. Xue, J. J. G. Tesmer and Y. Zhang. Using iterative fragment assembly and progressive sequence truncation to facilitate phasing and crystal structure determination of distantly related proteins. Acta Cryst. (2016). D72, 616-628

yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218