[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S775542

(Click on S775542_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format

>protein
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT

  Predicted Secondary Structure

Sequence                  20                  40                  60                  80
                   |                   |                   |                   |                   
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
PredictionCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHSSSSSCCCCCCCCCSSSSSCCCCCSSSCCCCHHHHHHHHHHHHHHCCCCCC
Conf.Score977999999999999999987026665788888456787896995792222663899999423443245798664797878999999999863537899
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20                  40                  60                  80
                   |                   |                   |                   |                   
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Prediction732212221332231011122333344463344002322644033520341344347704350003313663502142736103500530474466468
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)


  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
Hit
Iden1Iden2CovNorm.
Z-score
Download
Align.
                   20                  40                  60                  80
                   |                   |                   |                   |                   
Sec.Str
Seq
CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHSSSSSCCCCCCCCCSSSSSCCCCCSSSCCCCHHHHHHHHHHHHHHCCCCCC
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
11esrA 0.61 0.47 0.76 1.80Download ------------------------PDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKP
27s5aA 0.63 0.47 0.74 3.24Download -----------------------QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQN---
31don 1.00 0.77 0.77 1.98Download -----------------------QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
41don 1.00 0.77 0.77 1.45Download -----------------------QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
51donA 1.00 0.77 0.76 3.30Download ------------------------PDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
61don 1.00 0.77 0.76 2.21Download -----------------------QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPK-
71bo0A 0.71 0.55 0.77 1.94Download -----------------------QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
81donA 1.00 0.77 0.77 2.91Download -----------------------QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
97s58E 0.71 0.51 0.71 1.11Download -----------------------------TSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
101eihA 0.36 0.28 0.73 3.16Download ---------------------------VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQSCGDPKQEWVQRYMKNLDAKQKKASP
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: FFAS-3D   2: SPARKS-X   3: HHSEARCH2   4: HHSEARCH I   5: Neff-PPAS   6: HHSEARCH   7: pGenTHREADER   8: wdPPAS   9: PROSPECT2   10: SP3   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=-1.14 (Read more about C-score)
  • Estimated TM-score = 0.57±0.15
  • Estimated RMSD = 6.3±3.8Å

  • Download Model 2
  • C-score = -1.50

  • Download Model 3
  • C-score = -1.57

  • Download Model 4
  • C-score = -3.93

  • Download Model 5
  • C-score = -2.52


  Proteins structurally close to the target in the PDB (as identified by TM-align)

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)


Top 10 Identified stuctural analogs in PDB

Click
to view
RankPDB HitTM-scoreRMSDaIDENaCovAlignment
11esrA0.696 1.390.6080.748Download
21donA0.674 1.310.9070.737Download
31nr4E0.622 1.480.2320.697Download
41eigA0.616 1.900.3470.727Download
51f2lD0.602 1.900.3770.697Download
62vxwA0.602 1.990.2610.687Download
71zxtA0.592 1.780.3330.667Download
87f1qR0.592 2.170.3240.697Download
91mgsA0.592 2.130.1270.717Download
102q8rE0.592 1.620.3180.667Download

(a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.


  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites


Click
to view
RankC-scoreCluster
size
PDB
Hit
Lig
Name
Download
Complex
Ligand Binding Site Residues
10.08 4 1ilpA PEPTIDE Rep, Mult 34,36,37,38,39,41,42,43,44,46,47,65,68,72,73,74,75
20.07 4 5d65B BGC Rep, Mult 30,32,56,58
30.06 3 5dnfG BGC Rep, Mult 51,91
40.05 2 2ra4B TFA Rep, Mult 47,68,69,70,72
50.05 2 5d65A BGC Rep, Mult 62,77


Download the residue-specific ligand binding probability, which is estimated by SVM.
Download the all possible binding ligands and detailed prediction summary.
Download the templates clustering results.
(a)C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)Cluster size is the total number of templates in a cluster.
(c)Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column.
Mult is the complex structures with all potential binding ligands in the cluster.

  Enzyme Commission (EC) numbers and active sites


Click
to view
RankCscoreECPDB
Hit
TM-scoreRMSDaIDENaCovEC NumberActive Site Residues
10.1682e0wB0.486 4.190.0670.828 2.3.2.2  NA
20.1611rw9A0.526 3.890.0830.838 4.2.2.5  NA
30.1581ksdA0.458 4.290.0480.808 3.2.1.4  NA
40.1561ee8A0.461 4.300.0350.788 3.2.2.23  NA
50.1481ojnA0.492 4.280.0420.849 4.2.2.1  NA

 Click on the radio buttons to visualize predicted active site residues.
(a)CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1];
where a higher score indicates a more reliable EC number prediction.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided
by length of the query protein.

  Gene Ontology (GO) terms
Top 10 homologous GO templates in PDB 
RankCscoreGOTM-scoreRMSDaIDENaCovPDB HitAssociated GO Terms
1 0.280.6964 1.39 0.61 0.751esrA GO:0007165 GO:0005576 GO:0004871 GO:0005615 GO:0008009 GO:0006954 GO:0009615 GO:0005125 GO:0006816 GO:0008201 GO:0006887 GO:0006935 GO:0007267 GO:0006955
2 0.270.6221 1.48 0.23 0.701nr4E GO:0007267 GO:0005125 GO:0008009 GO:0005576 GO:0007275 GO:0007186 GO:0006954 GO:0006935 GO:0005615 GO:0005102 GO:0006955
3 0.270.6015 1.99 0.26 0.692vxwA GO:0043621 GO:0010535 GO:0050918 GO:0005737 GO:0048247 GO:0043623 GO:0031328 GO:0042803 GO:0009615 GO:0002676 GO:0042119 GO:0070233 GO:0007568 GO:0051384 GO:0048661 GO:0048246 GO:0042327 GO:0045672 GO:0010759 GO:0005125 GO:0005615 GO:0045070 GO:0070100 GO:0045948 GO:0034612 GO:0042102 GO:0045071 GO:0046817 GO:0050863 GO:0046427 GO:0002544 GO:0031622 GO:0042056 GO:0090026 GO:0031726 GO:0070098 GO:0042531 GO:0007159 GO:0031730 GO:0031584 GO:0006954 GO:0010820 GO:0042379 GO:0030298 GO:0002407 GO:0005625 GO:0032868 GO:0034097 GO:0031729 GO:0007267 GO:0006935 GO:0034112 GO:0070234 GO:0051262 GO:0014068 GO:0042493 GO:0045785 GO:0033634 GO:0048245 GO:0008009 GO:0032496 GO:0005576 GO:0014911 GO:0045089 GO:0006955
4 0.270.6728 1.77 0.99 0.761domA GO:0031727 GO:0033552 GO:0045471 GO:0046677 GO:0043615 GO:0035684 GO:0009612 GO:0006935 GO:0001666 GO:0009408 GO:0031100 GO:0042493 GO:0043025 GO:0048246 GO:0048247 GO:0071222 GO:0071346 GO:0005125 GO:0004871 GO:0008009 GO:0007165 GO:0006916 GO:0051770 GO:0006954 GO:0019221 GO:0032496 GO:0002548 GO:0005737 GO:0070098 GO:0030593 GO:0048010 GO:0051384 GO:0060137 GO:0043277 GO:0001525 GO:0019725 GO:0007155 GO:0007187 GO:0004672 GO:0005576 GO:0005102 GO:0006959 GO:0007186 GO:0009887 GO:0007179 GO:0008201 GO:0010332 GO:0014823 GO:0043200 GO:0071356 GO:0005515 GO:0007259 GO:0019079 GO:0050870 GO:0032570 GO:0005615 GO:0001938 GO:0050806 GO:0071347 GO:0009617 GO:0006468 GO:0007166 GO:0006874 GO:0006955
5 0.250.6160 1.90 0.35 0.731eigA GO:0005576 GO:0006955 GO:0008009
6 0.210.5918 2.13 0.13 0.721mgsA GO:0008047 GO:0008285 GO:0007186 GO:0007165 GO:0005615 GO:0005125 GO:0043085 GO:0007399 GO:0006935 GO:0006954 GO:0005576 GO:0005102 GO:0035556 GO:0008283 GO:0008083 GO:0030036 GO:0008009 GO:0005622 GO:0006955
7 0.200.5739 2.18 0.23 0.711qe6D GO:0005622 GO:0042119 GO:0008009 GO:0005615 GO:0007186 GO:0005515 GO:0005576 GO:0048566 GO:0005153 GO:0045091 GO:0071222 GO:0008285 GO:0035556 GO:0030593 GO:0006954 GO:0007050 GO:0019722 GO:0006935 GO:0002237 GO:0001525 GO:0050930 GO:0030155 GO:0006928 GO:0090023 GO:0007165 GO:0005125 GO:0006955
8 0.200.5908 2.09 0.61 0.691eotA GO:0002544 GO:0030335 GO:0006468 GO:0070670 GO:0008009 GO:0005125 GO:0001938 GO:0032855 GO:0007165 GO:0009615 GO:0006874 GO:0060763 GO:0005576 GO:0060444 GO:0006935 GO:0030838 GO:0048245 GO:0007155 GO:0009314 GO:0005615 GO:0006954 GO:0045766 GO:0006955
9 0.200.5921 1.78 0.33 0.671zxtA GO:0005576 GO:0006955 GO:0008009
10 0.190.5915 1.62 0.32 0.672q8rE GO:0005515 GO:0005125 GO:0004871 GO:0005615 GO:0005576 GO:0008284 GO:0006874 GO:0007165 GO:0006955 GO:0008009


Consensus prediction of GO terms
 
Molecular Function GO:0008009 GO:0030296 GO:0048019 GO:0048020 GO:0042802 GO:0008201 GO:0004871
GO-Score 0.79 0.53 0.53 0.53 0.53 0.47 0.47
Biological Process GO:0032940 GO:0070838 GO:0051259 GO:0071675 GO:0014066 GO:0002675 GO:0043434 GO:0033632 GO:0070229 GO:2000243
GO-Score 0.56 0.56 0.53 0.53 0.53 0.53 0.53 0.53 0.53 0.53
Cellular Component GO:0005615 GO:0000267 GO:0044297 GO:0005737
GO-Score 0.72 0.53 0.53 0.46

(a)CscoreGO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on CscoreGO of the template.


[Click on S775542_results.tar.bz2 to download the tarball file including all modeling results listed on this page]



Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.