[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S776917

(Click on S776917_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format

>protein
KREFRFQLRGVAFVMVEDGWKLLKPEEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLG
TEDIISTKQYVEVLSRIFKNSEGKQLDP

  Predicted Secondary Structure

Sequence                  20                  40                  60                  80
                   |                   |                   |                   |        
KREFRFQLRGVAFVMVEDGWKLLKPEEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLGTEDIISTKQYVEVLSRIFKNSEGKQLDP
PredictionCHHHHHHHCCCCSSSSSCCCCCCCHHHHSSCCCCHHCCCCSSSSCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
Conf.Score9278898658988998147753378890243893321787365287888779999998099788889999999999999737987897
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20                  40                  60                  80
                   |                   |                   |                   |        
KREFRFQLRGVAFVMVEDGWKLLKPEEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLGTEDIISTKQYVEVLSRIFKNSEGKQLDP
Prediction8641364047131011343441040430024065575040102422552241350043033654142530140043017517756368
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)


  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
Hit
Iden1Iden2CovNorm.
Z-score
Download
Align.
                   20                  40                  60                  80
                   |                   |                   |                   |        
Sec.Str
Seq
CHHHHHHHCCCCSSSSSCCCCCCCHHHHSSCCCCHHCCCCSSSSCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
KREFRFQLRGVAFVMVEDGWKLLKPEEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLGTEDIISTKQYVEVLSRIFKNSEGKQLDP
13kfvA 0.14 0.25 0.84 0.58Download -DTVRVIAEKDKHALLD-----VTPSAI--ERLNYVQYYPIVFFIPESRPALKALRQWLAPASRRSTRRLYAQAQKLRKHSS------
27pegA 0.16 0.19 0.86 0.67Download ADEAADKVTDLADIIVAGNQ-----AYVAVVLTNGNK------GAVEN-NLKKKIAKKVRSTDYVSAPDFVERMQGYGKRIQGDPIAG
34btjA 0.11 0.26 0.72 0.71Download KEQVGMIKEKYE------------HRMLLKH-------------MPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEA
47a9wA 0.22 0.31 0.42 0.76Download -----------------------------------------LYHIPRTIISYRILLKSLGSIDNTNNEEILDRWLELV----------
56psdE 0.14 0.18 0.78 0.47Download QLVMLRKAQEF-FQTCDEGKGFIARKDMQRLHKE----------LPLSLEELEDVFDALDADGNLTPQEFTTGFSHFFFS--------
66xehA 0.11 0.25 0.99 0.75Download KKEIIDRLKNIDMIIVKTEDKESISEIIKQVLDSGAKV-LILSSDENIIESIRKQYPKVETRRAQDKEEVKDAVEEFLKEGGSLEHHH
71vt4A 0.14 0.23 0.89 0.97Download FRFLEQKIRHDSTAWNASGSILNTLQQLKF-------YKPYICDNDPKYERILDFLPK--IEENLICSKYTDLLRIAL-MAEDEIFEE
83hjcA 0.20 0.41 0.93 0.26Download ER-----LSTSPCILVTSEFGWSAHMEQIMRNQQYMMSKKTMELNPRH-PIIKELRRRVGADNDKAVKDLVFLLFDTSLLTSGFQLDP
97k65A 0.13 0.38 0.76 0.54Download MDQIIEYL--YPCLIIWEGAKLQSGTKPPLRWT---NFDPINYQ----VDSWEEMLNKAEVGHGYM------------DRPCLNPADP
107tujA 0.13 0.23 0.90 0.49Download AQMPSAGGAQKP-----EGLEPKGANRKKNLPPKVPIPMPQYSIMEPVL---KKELDRFGVRPL-PKRQMVLKLKEIFQYLDSDSEDE
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: FFAS-3D   2: SPARKS-X   3: SP3   4: HHSEARCH   5: wdPPAS   6: Neff-PPAS   7: HHSEARCH2   8: pGenTHREADER   9: HHSEARCH I   10: PROSPECT2   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=-3.82 (Read more about C-score)
  • Estimated TM-score = 0.30±0.10
  • Estimated RMSD = 12.3±4.4Å

  • Download Model 2
  • C-score = -4.15

  • Download Model 3
  • C-score = -4.35

  • Download Model 4
  • C-score = -4.37

  • Download Model 5
  • C-score = -4.81


  Proteins structurally close to the target in the PDB (as identified by TM-align)

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)


Top 10 Identified stuctural analogs in PDB

Click
to view
RankPDB HitTM-scoreRMSDaIDENaCovAlignment
16nesA0.536 3.450.0380.784Download
26c6nA0.533 3.550.0790.807Download
32o9dB0.522 4.120.1280.898Download
43llqB0.517 4.110.1050.909Download
58x38A0.513 3.040.1100.739Download
62f2bA0.512 4.100.0700.886Download
73ne2C0.511 4.200.0800.898Download
88eynA0.508 4.370.0350.909Download
91z98A0.506 4.330.0340.943Download
102w2eA0.505 4.030.0470.898Download

(a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.


  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites


Click
to view
RankC-scoreCluster
size
PDB
Hit
Lig
Name
Download
Complex
Ligand Binding Site Residues
10.18 10 1yhuD OXY Rep, Mult 15,56,73,77
20.05 3 2buqA CAQ N/A 40,41
30.04 2 5c5xE PS6 Rep, Mult 50,55
40.04 2 1aiiA ETA N/A 60,61
50.02 1 2evuA GOL Rep, Mult 54,58,73


Download the residue-specific ligand binding probability, which is estimated by SVM.
Download the all possible binding ligands and detailed prediction summary.
Download the templates clustering results.
(a)C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)Cluster size is the total number of templates in a cluster.
(c)Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column.
Mult is the complex structures with all potential binding ligands in the cluster.

  Enzyme Commission (EC) numbers and active sites


Click
to view
RankCscoreECPDB
Hit
TM-scoreRMSDaIDENaCovEC NumberActive Site Residues
10.0661t09B0.501 3.920.0710.852 1.1.1.42  NA
20.0661t09A0.473 3.920.0760.818 1.1.1.42  NA
30.0661qo9A0.487 4.170.0370.886 3.1.1.7  NA
40.0661eveA0.377 4.270.0510.705 3.1.1.7  NA
50.0651gz3A0.479 3.930.0740.852 1.1.1.38  NA

 Click on the radio buttons to visualize predicted active site residues.
(a)CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1];
where a higher score indicates a more reliable EC number prediction.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided
by length of the query protein.

  Gene Ontology (GO) terms
Top 10 homologous GO templates in PDB 
RankCscoreGOTM-scoreRMSDaIDENaCovPDB HitAssociated GO Terms
1 0.070.4872 4.17 0.04 0.891qo9A GO:0003990 GO:0006581 GO:0016020 GO:0005737 GO:0043083 GO:0016787 GO:0042426 GO:0030054 GO:0004104 GO:0005886 GO:0042803 GO:0045202 GO:0031225 GO:0042135 GO:0004091 GO:0007268 GO:0042331 GO:0001507
2 0.070.5047 4.14 0.04 0.912w1pA GO:0005215 GO:0006810 GO:0006833 GO:0016020 GO:0016021 GO:0055085
3 0.070.4940 4.02 0.07 0.862qfwD GO:0004450 GO:0042645 GO:0006537 GO:0006102 GO:0055114 GO:0046872 GO:0006097 GO:0016491 GO:0005739 GO:0005515 GO:0006099 GO:0000287 GO:0016616 GO:0051287
4 0.070.4788 3.93 0.07 0.851gz3A GO:0043231 GO:0046872 GO:0016619 GO:0009055 GO:0004471 GO:0008152 GO:0055114 GO:0003824 GO:0051287 GO:0016491 GO:0016616 GO:0005739 GO:0005759 GO:0004470 GO:0005488 GO:0006108
5 0.060.5027 4.15 0.09 0.881gq2A GO:0046872 GO:0004473 GO:0016491 GO:0055114 GO:0005737 GO:0004470 GO:0005488 GO:0006108 GO:0016616 GO:0051287
6 0.060.4882 3.98 0.09 0.813qyeA GO:0005097 GO:0005622 GO:0032313
7 0.060.4858 3.92 0.08 0.803qybA GO:0005097 GO:0005622 GO:0032313
8 0.060.4907 4.38 0.06 0.853k17A GO:0016740 GO:0016301 GO:0016310 GO:0000166 GO:0005524 GO:0005737 GO:0008152 GO:0016773
9 0.060.5056 4.33 0.03 0.941z98A GO:0006810 GO:0006833 GO:0005215 GO:0016020 GO:0016021 GO:0055085
10 0.060.4996 4.24 0.01 0.901j4nA GO:0032127 GO:0071472 GO:0006813 GO:0048593 GO:0015696 GO:0071456 GO:0005223 GO:0022857 GO:0003094 GO:0042060 GO:0006833 GO:0071300 GO:0071474 GO:0071288 GO:0033363 GO:0071241 GO:0071549 GO:0005267 GO:0031526 GO:0019233 GO:0030184 GO:0070301 GO:0070062 GO:0085018 GO:0035377 GO:0042493 GO:0071280 GO:0055085 GO:0042383 GO:0015250 GO:0045177 GO:0020003 GO:0015168 GO:0015670 GO:0016323 GO:0071260 GO:0051739 GO:0015793 GO:0072230 GO:0072232 GO:0071805 GO:0031965 GO:0021670 GO:0033554 GO:0003097 GO:0032940 GO:0048146 GO:0071320 GO:0000299 GO:0006884 GO:0005634 GO:0005886 GO:0016020 GO:0044241 GO:0009925 GO:0016021 GO:0005624 GO:0030104 GO:0035378 GO:0070295 GO:0030950 GO:0006810 GO:0046878 GO:0005903 GO:0030335 GO:0005372 GO:0072220 GO:0034644 GO:0030185 GO:0005215 GO:0019725 GO:0043066 GO:0015079 GO:0033267 GO:0045766 GO:0016324 GO:0006182 GO:0035379 GO:0051458 GO:0072239


Consensus prediction of GO terms
 
Molecular Function GO:0043167
GO-Score 0.37
Biological Process GO:0006108 GO:0001507 GO:0042426 GO:0042331 GO:0006097 GO:0055085 GO:0006537 GO:0006833 GO:0006102 GO:0006099
GO-Score 0.13 0.07 0.07 0.07 0.07 0.07 0.07 0.07 0.07 0.07
Cellular Component GO:0030054 GO:0005886 GO:0043083 GO:0031225 GO:0042645 GO:0016021
GO-Score 0.07 0.07 0.07 0.07 0.07 0.07

(a)CscoreGO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on CscoreGO of the template.


[Click on S776917_results.tar.bz2 to download the tarball file including all modeling results listed on this page]



Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.