Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	Ifenprodil
Molecular formula	C21H27NO2
IUPAC name	4-[2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl]phenol
Molecular weight	325.452
Hydrogen bond acceptor	3
Hydrogen bond donor	2
XlogP	3.9
Synonyms	SR-01000075169 2-(4-benzylpiperidino)-1-(4-hydroxyphenyl)-2-methyl-1-ethanol Vadilex 4-[2-(4-Benzyl-1-piperidyl)-1-hydroxy-propyl]phenol; (2R,3R)-2,3-dihydroxybutanedioic acid alpha-(4-Hydroxyphenyl)-beta-methyl-4-(phenylmethyl)-1-piperidine ethanol CHEBI:93829 DB08954 GTPL5472 Ifenprodil tartrate salt MRF-0000097 NCGC00024643-12 (plusmn)-ifenprodil SR-01000075169-3 23210-56-2 61 91 RC BRD-A24191444-045-03-1 ChEMBL_104385 DSSTox_GSID_45656 Ifenprodilum [INN-Latin] NCGC00024643-04 R8OE3P6O5S SBI-0050640.P002 1-Piperidineethanol, alpha-(4-hydroxyphenyl)-beta-methyl-4-(phenylmethyl)- UNII-R8OE3P6O5S 4-Benzyl-alpha-(p-hydroxyphenyl)-beta-methyl-1-piperidineethanol AKOS015895174 CC-29467 D08VCI EINECS 245-491-4 Ifenprodil L-(+)-tartrate L005364 NCGC00024643-07 SR-01000075169-1 2-(4-Benzylpiperidino)-1-(4-hydroxyphenyl)propanol 4-[2-(4-Benzyl-piperidin-1-yl)-1-hydroxy-propyl]-phenol AX8042605 Dilvax HMS2089G05 Ifenprodil [INN:DCF] NCGC00024643-02 PDSP1_000654 1-Methyl-2-hydroxy-2-(4-hydroxyphenyl)ethyl-1-(4-benzylpiperidine) Tox21_110915 23210-58-4 925913-11-7 C-19841 Creocral DSSTox_RID_81034 Ifenprodil (INN) J-015034 NCGC00024643-05 RC 61-91 SCHEMBL34010 1-Piperidineethanol, alpha-(4-hydroxyphenyl)-beta-methyl-4-(phenylmethyl)- (9CI) UYNVMODNBIQBMV-UHFFFAOYSA-N 4-[1-hydroxy-2-[4-(phenylmethyl)-1-piperidinyl]propyl]phenol Alpha 1-PI CCG-204747 D0I0DL FT-0601591 ifenprodil tartrate LS-115339 NCGC00024643-10 (+/-)-[2-(4-benzylpiperidino)-1-(4-hydroxyphenyl)-1-propanol] SR-01000075169-11 210I562 4-[2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl]phenol BDBM50083351 CHEMBL305187 DSSTox_CID_25656 I06-0297 Ifenprodilum NCGC00024643-03 PDSP2_000646 1-Piperidineethanol, 4-benzyl-alpha-(p-hydroxyphenyl)-beta-methyl- Tox21_110915_1 4-(2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl)phenol AC1L1GHT CAS-23210-56-2 D08064 DTXSID2045656 IFENPRODIL HEMITARTRATE KB-52538 NCGC00024643-06 RC-61-91 [ Show all ]
Inchi Key	UYNVMODNBIQBMV-UHFFFAOYSA-N
Inchi ID	InChI=1S/C21H27NO2/c1-16(21(24)19-7-9-20(23)10-8-19)22-13-11-18(12-14-22)15-17-5-3-2-4-6-17/h2-10,16,18,21,23-24H,11-15H2,1H3
PubChem CID	3689
ChEMBL	CHEMBL305187
IUPHAR	N/A
BindingDB	N/A
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	<1000.0 nM	PMID1681106	ChEMBL

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218