Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	P2Y purinoceptor 6
Species	Homo sapiens (Human)
Gene	P2RY6
Synonym	pyrimidinergic receptor P2Y P2Y6 receptor P2Y6 P2Y purinoceptor 6 P2Y ATP receptor 6 uridine nucleotide receptor [ Show all ]
Disease	N/A
Length	328
Amino acid sequence	MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR
UniProt	Q15077
Protein Data Bank	N/A
GPCR-HGmod model	Q15077
3D structure model	This predicted structure model is from GPCR-EXP Q15077.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4714
IUPHAR	326
DrugBank	N/A

Ligand

Name	Uridine 5'-diphosphate
Molecular formula	C9H14N2O12P2
IUPAC name	[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphono hydrogen phosphate
Molecular weight	404.161
Hydrogen bond acceptor	12
Hydrogen bond donor	6
XlogP	-4.7
Synonyms	Uridine 5'-(trihydrogen diphosphate-P-32P) (9CI) Uridine diphosphate (6CI) V1660 ((2R,3S,4R,5R)-5-(2,4-Dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl trihydrogen diphosphate BDBM50403871 D02HAL LS-160842 Uridine, 5'-(trihydrogen diphosphate) [(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl]methyl phosphono hydrogen phosphate 1gx4 AC1L1LNF C9H14N2O12P2 EINECS 200-409-6 UDP Uridine 5'-(trihydrogen diphosphate) Uridine 5'-pyrophosphoric acid uridine-diphosphate 5'-UDP AN-41775 CHEMBL130266 GTPL1749 Uridine 5'-(trihydrogen pyrophosphate) Uridine Pyrophosphate XCCTYIAWTASOJW-XVFCMESISA-N 58-98-0 bmse000266 DB-053298 NCGC00163324-01 Uridine 5'-pyrophosphate uridine-5'-diphosphate [(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphono hydrogen phosphate 1o7o AC1Q1I4G CHEBI:17659 FT-0601269 UNII-5G0F599A1Y Uridine 5'-(trihydrogen diphosphate) (9CI) URIDINE DIPHOSPHATE URIDINE_DIPHOSPHATE BDBM50118239 CTK1G9536 Lopac0_001205 Uridine 5'-(trihydrogen pyrophosphate) (8CI) Uridine pyrophosphate (7CI) ZINC4490939 1gww 5G0F599A1Y C00015 DB03435 SCHEMBL4245 Uridine 5'-pyrophosphorate uridine-5-pyrophosphoric acid [({[(2R,3S,4R,5R)-5-(2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)oxy]phosphonic acid 2,4(1H,3H)-pyrimidinedione, 1-[5-O-[hydroxy(phosphonooxy)phosphinyl]-beta-D-ribofuranosyl]- AKOS028109013 FT-0615129 uridine 5''-(trihydrogen diphosphate) [ Show all ]
Inchi Key	XCCTYIAWTASOJW-XVFCMESISA-N
Inchi ID	InChI=1S/C9H14N2O12P2/c12-5-1-2-11(9(15)10-5)8-7(14)6(13)4(22-8)3-21-25(19,20)23-24(16,17)18/h1-2,4,6-8,13-14H,3H2,(H,19,20)(H,10,12,15)(H2,16,17,18)/t4-,6-,7-,8-/m1/s1
PubChem CID	6031
ChEMBL	CHEMBL130266
IUPHAR	1749
BindingDB	50403871, 50118239
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand has more than 5 hydrogen bond donor. This ligand has more than 10 hydrogen bond acceptor.

Experimental Data

Parameter	Value	Reference	Database source
EC50	13.0 nM	PMID16942026	BindingDB,ChEMBL
EC50	15.0 nM	PMID22901672, PMID11754592	BindingDB,ChEMBL
EC50	42.0 nM	PMID17125260	BindingDB,ChEMBL
EC50	47.0 nM	PMID22901672	BindingDB,ChEMBL
EC50	48.0 nM	PMID21417463	BindingDB,ChEMBL
EC50	86.0 nM	PMID16366591	BindingDB,ChEMBL
EC50	100.0 nM	PMID11206448	BindingDB,ChEMBL
EC50	140.0 nM	PMID20095577	BindingDB,ChEMBL
EC50	150.0 nM	PMID22901672	BindingDB,ChEMBL
EC50	300.0 nM	PMID12213051, PMID20446735, PMID18514530	BindingDB,ChEMBL
EC50	316.228 nM	PMID8670200	IUPHAR
EC50	530.0 nM	PMID19902968	BindingDB,ChEMBL

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218