Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services


TM-score TM-align MM-align RNA-align NW-align LS-align EDTSurf MVP MVP-Fit SPICKER HAAD PSSpred 3DRobot MR-REX I-TASSER-MR SVMSEQ NeBcon ResPRE WDL-RF ATPbind DockRMSD DeepMSA FASPR EM-Refiner


You can:


NameNeuromedin-B receptor
SpeciesRattus norvegicus (Rat)
BB1 receptor
neuromedin B receptor
neuromedin-B-preferring bombesin receptor
DiseaseN/A for non-human GPCRs
Protein Data BankN/A
GPCR-HGmod modelN/A
3D structure modelNo available structures or models
Therapeutic Target DatabaseN/A

Known ligands

You can:

Total entries: 82
Page:  / 1 

GLASS IDMoleculeFormulaMolecular weightH-bond acceptor / donorXlogPLipinski's druglikeness
5532612D structurePD 168368C31H34N6O4554.6515 / 45.2No
117492D structureDPhe6-Bn(6-13)NH2C47H65N13O9956.11911 / 120.7No
5363032D structureSCHEMBL1251302C68H100N18O18S1489.7224 / 16-7.2No
148312D structureRanatensinC61H84N16O13S1281.515 / 140.4No
5364672D structureCHEMBL3951222C68H98ClN19O18S1537.1624 / 17-7.3No
5481402D structureCHEMBL3914573C68H106N20O21S21603.8325 / 20-6.8No
390852D structureBDBM85504C72H101N17O131412.7115 / 151.8No
5373842D structureSCHEMBL1251393C85H131N19O19S1755.1625 / 17-4.0No
5485872D structureCHEMBL3891981C68H99N19O19S1518.7125 / 18-8.3No
5535562D structureKuwanon HC45H44O11760.83611 / 89.2No
5375212D structureSCHEMBL1392465C85H133N19O20S1773.1726 / 19-5.0No
5487212D structureCHEMBL3942065C59H91N17O16S1326.5422 / 15-8.1No
5377192D structureSCHEMBL1251567C85H133N19O19S1757.1725 / 18-3.7No
5487352D structureCHEMBL3906914C69H110N22O18S21599.924 / 20-4.6No
5378342D structure55749-98-9C38H57N11O7S812.00410 / 101.0No
5488952D structureCHEMBL3954412C88H115N19O19S1775.0625 / 17-2.9No
5490592D structureCHEMBL3946856C67H107N21O18S21558.8423 / 21-4.3No
5384172D structureCHEMBL3890803C71H98N18O18S1523.7324 / 17-6.8No
998472D structureBDBM85488C57H76N14O101117.3212 / 132.5No
5384662D structureCHEMBL3894747C68H100N20O18S1517.7325 / 18-7.1No
5386292D structureSCHEMBL1250067C69H101N19O18S1516.7424 / 17-7.6No
1081722D structureCAS_lC57H76N14O91101.3212 / 122.0No
5492412D structureCHEMBL3944194C61H82N16O14S1295.4817 / 17-0.6No
5493032D structureCHEMBL3967904C79H117N25O21S1785.0225 / 26-6.9No
1207032D structureDPhe6-Bn(6-13)methylesterC48H66N12O10971.1312 / 111.6No
5391442D structureSCHEMBL1252671C69H101N19O18S1516.7424 / 16-7.8No
1261162D structureDPhe6-Bn(6-13)propylamideC50H71N13O9998.211 / 121.9No
5392032D structureSCHEMBL1252293C68H99N19O18S1502.7124 / 17-8.0No
5495612D structureCHEMBL3952732C69H100N18O18S1501.7325 / 16-7.7No
5394042D structureSCHEMBL1252416C68H99N19O18S1502.7124 / 17-8.0No
5496212D structureCHEMBL3894546C87H115N19O18S1747.0524 / 17-2.6No
5496422D structureCHEMBL3929807C77H121N19O18S1632.9924 / 17-3.2No
1406552D structureAlytesinC68H106N22O17S1535.7920 / 21-3.2No
5496772D structureCHEMBL3944228C69H109N21O19S21600.8824 / 21-6.0No
1610322D structureDPhe6-Bn[6-14)C52H74N14O10S1087.3113 / 131.0No
5404752D structureSCHEMBL1252581C67H98N18O17S1459.6923 / 16-7.4No
5501222D structureCHEMBL3939368C68H108N18O171449.7222 / 16-6.0No
1805682D structure123809-85-8C72H114N24O171587.8520 / 22-3.9No
2032972D structureDPhe6-Bn(6-13)hydrazideC47H66N14O9971.13412 / 130.3No
2091512D structureDPhe6,12,Leu14-BnC80H117N21O171644.9518 / 200.8No
5505382D structureCHEMBL3932563C63H98N18O17S1411.6523 / 16-8.5No
2142842D structureBDBM85490C50H69N15O91024.213 / 130.2No
5506262D structureCHEMBL3963362C73H102N18O17S1535.7923 / 16-5.7No
2268142D structureRhodei-LitorinC51H69N13O11S1072.2513 / 130.6No
2348052D structureCID 101690278C74H112N22O18S1629.9138 / 267.5No
5422512D structureCHEMBL3979188C67H106N18O17S1467.7523 / 16-6.7No
5423032D structureCHEMBL3974709C69H101N19O18S1516.7424 / 17-7.9No
2412162D structureBDBM85498C51H68N14O11S1085.2513 / 13-0.3No
5508902D structureCHEMBL3976771C62H96N18O17S1397.6223 / 16-8.9No
2526872D structurePhyllolitorin, leu-8-C46H71N11O11S986.212 / 121.1No
2577882D structureDPhe6-Bn(1-13)NH2C71H104N22O161521.7518 / 20-2.1No
2643002D structureCID 16138288C74H108N24O18S1653.8921 / 23-4.2No
5511992D structureCHEMBL3947283C70H111N21O19S21614.9124 / 18-4.1No
5512402D structureCHEMBL3982672C81H117N19O18S1677.024 / 17-3.1No
2688842D structurevplpagggtvltkmyprgnhwavghlm-nh2C130H204N38O31S22859.4238 / 36-2.2No
5512502D structureCHEMBL3904512C67H107N21O18S21558.8423 / 21-4.3No
5433782D structureCHEMBL3903246C67H103N19O18S1494.7424 / 16-8.8No
2857192D structureDPhe6-Bn(6-13)hexylamideC53H77N13O91040.2811 / 123.4No
5514712D structureCHEMBL3889538C73H106N20O18S1583.8324 / 15-7.4No
5514882D structureCHEMBL3971676C75H105N19O18S1592.8424 / 17-6.0No
2896332D structurePX9AZU7QPKC71H110N24O18S1619.8721 / 23-4.4No
2917912D structureBDBM85485C49H70N14O9999.18812 / 121.3No
5515972D structureCHEMBL3982939C60H93N19O16S21400.6420 / 18-3.1No
3059252D structurePD165929C37H47N5O2593.8163 / 47.7No
3065812D structureneuromedin CC50H73N17O11S1120.315 / 15-1.8No
3065852D structureneuromedin CC50H73N17O11S1120.315 / 15-1.8No
3132322D structureBDBM85505C62H74N14O10S1207.4212 / 142.5No
3182872D structureBDBM85493C52H75N13O101042.2512 / 132.3No
5520222D structureCHEMBL3963000C62H89N17O16S1360.5622 / 15-7.9No
3325482D structurePG-LC62H86N18O16S1371.5419 / 17-5.0No
5450012D structureSCHEMBL1251596C68H100N18O18S1489.7224 / 16-7.4No
3375792D structureBDBM85483C49H69N11O11S1020.2212 / 121.3No
5522202D structureCHEMBL3923123C70H114N22O17S21599.9423 / 21-3.5No
3456512D structureBombesin, SAPC74H108N24O19S1669.8922 / 23-5.6No
5523252D structureCHEMBL3970735C62H96N20O17S21457.6921 / 19-3.8No
5524172D structureCHEMBL3980433C67H106N20O17S1495.7725 / 16-9.0No
5458832D structureBombesin(7-14)C43H65N13O9S940.13512 / 12-0.3No
3688622D structureCHEMBL217438C63H73N11O9S21192.4613 / 125.9No
5526042D structureCHEMBL3907272C67H107N23O18S21586.8623 / 22-5.2No
5527662D structureCHEMBL3974250C64H100N20O19S21517.7423 / 21-5.1No
5471662D structureNeuromedin BC52H73N15O12S1132.3115 / 15-1.6No
5478112D structureCHEMBL3953912C68H99N19O18S1502.7124 / 17-8.0No

yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218