Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	G-protein coupled receptor 6
Species	Homo sapiens (Human)
Gene	GPR6
Synonym	GPR6 Sphingosine 1-phosphate receptor GPR6
Disease	N/A
Length	362
Amino acid sequence	MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV
UniProt	P46095
Protein Data Bank	N/A
GPCR-HGmod model	P46095
3D structure model	This predicted structure model is from GPCR-EXP P46095.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3714130
IUPHAR	N/A
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
521566	CHEMBL3718030	C24H22ClF4N5O3	539.916	12 / 2	N/A	No
517348	CHEMBL3912262	C26H36F2N6O2	502.611	10 / 1	3.5	No
517353	CHEMBL3912855	C23H30FN5O3S	475.583	8 / 1	2.3	Yes
536160	CHEMBL3908467	C26H33F2N5O3	501.579	9 / 1	3.6	No
521717	CHEMBL3718559	C23H23ClN6O	434.928	6 / 1	3.5	Yes
521794	SCHEMBL7087976	C15H13N3OS2	315.409	3 / 2	2.8	Yes
536322	CHEMBL3940326	C24H31F2N5O2	459.542	8 / 1	3.6	Yes
521879	CHEMBL3716859	C22H22N6O	386.459	7 / 1	3.4	Yes
517393	CHEMBL3950698	C26H31FN6O2	478.572	8 / 1	3.3	Yes
521922	CHEMBL3717929	C26H24ClF3N6O2	544.963	11 / 2	N/A	No
522009	CHEMBL3716373	C23H23F5N6O2	510.469	13 / 2	N/A	No
522067	CHEMBL3717716	C23H23F5N6O2	510.469	13 / 2	N/A	No
536524	CHEMBL3945233	C23H27F4N5O2	481.496	10 / 1	3.7	Yes
522226	CHEMBL3714945	C24H25F4N5O4	523.489	13 / 2	N/A	No
558021	SCHEMBL16843319	C23H28F3N5O2	463.505	9 / 1	3.2	Yes
548164	CHEMBL3956900	C23H28F3N5O2	463.505	9 / 1	3.2	Yes
522324	CHEMBL3719320	C27H31F4N7O4	593.584	14 / 2	N/A	No
536633	CHEMBL3921525	C25H33F3N6O	490.575	8 / 1	3.6	Yes
522395	CHEMBL3716133	C25H26F3N5O5S	565.568	12 / 2	N/A	No
536700	CHEMBL3892898	C22H27F4N5O3S	517.544	12 / 1	3.5	No
517462	CHEMBL3902976	C24H29FN6O2	452.534	8 / 1	2.8	Yes
522408	CHEMBL3714886	C23H24F4N6O3S	540.538	14 / 2	N/A	No
517470	CHEMBL3965158	C24H31F2N5O2	459.542	8 / 1	3.6	Yes
522545	CHEMBL3714978	C24H23BrCl2F3N5O2	621.28	10 / 2	N/A	No
522627	CHEMBL3717213	C24H22ClF3N6O4S	582.983	13 / 2	N/A	No
522640	SCHEMBL7090496	C11H10FN3OS2	283.339	4 / 2	1.7	Yes
522654	SCHEMBL7089343	C12H13N3O2S2	295.375	4 / 2	1.5	Yes
522661	CHEMBL3716681	C25H26F5N5O2	523.508	12 / 2	N/A	No
522666	SCHEMBL7087952	C13H11N3OS3	321.431	4 / 2	2.9	Yes
522789	CHEMBL3718420	C26H22Cl2N6	489.404	6 / 1	5.8	No
517525	CHEMBL3958294	C21H34N6O3	418.542	7 / 1	1.4	Yes
522801	CHEMBL3714860	C23H20Cl2N6O	467.354	7 / 1	4.6	Yes
522803	CHEMBL3716923	C25H25F6N5O2	541.498	13 / 2	N/A	No
537159	CHEMBL3949818	C25H31F4N5O3	525.549	11 / 1	3.9	No
558704	SCHEMBL16818294	C25H31F4N5O3	525.549	11 / 1	3.9	No
522859	CHEMBL3717270	C25H22ClF3N6O3	546.935	11 / 2	N/A	No
522860	CHEMBL3718669	C24H26Cl2F3N5O2	544.4	10 / 2	N/A	No
522863	AC1NC1KY	C11H11N3OS2	265.349	3 / 2	1.6	Yes
522904	CHEMBL3716757	C24H25F6N5O2	529.487	13 / 2	N/A	No
522935	SCHEMBL7084453	C11H10FN3OS2	283.339	4 / 2	1.7	Yes
522953	CHEMBL3718285	C23H22N6O2S	446.529	8 / 1	3.1	Yes
522999	CHEMBL3717693	C28H28F6N6O3	610.561	14 / 2	N/A	No
523000	CHEMBL3716246	C28H28F6N6O3	610.561	14 / 2	N/A	No
523001	CHEMBL3715082	C24H21ClF5N5O3	557.906	13 / 2	N/A	No
523037	CHEMBL3718714	C24H28F4N6O4	540.52	14 / 2	N/A	No
523038	CHEMBL3719318	C24H28F4N6O4	540.52	14 / 2	N/A	No
523055	CHEMBL3714997	C23H25F3N6O2	474.488	11 / 2	N/A	No
523060	CHEMBL3717583	C23H23F4N5	445.466	9 / 1	5.0	Yes
517592	CHEMBL3927734	C23H30FN5O3S	475.583	8 / 1	2.3	Yes
537398	CHEMBL3916279	C24H30F2N6O2	472.541	9 / 1	1.5	Yes
559034	SCHEMBL16818198	C24H30F2N6O2	472.541	9 / 1	1.5	Yes
523239	CHEMBL3717674	C23H27F3N6O4	508.502	13 / 2	N/A	No
537414	CHEMBL3940225	C23H27F4N5O2	481.496	10 / 1	3.6	Yes
517616	CHEMBL3902181	C23H32FN5O2	429.54	8 / 1	3.6	Yes
517617	CHEMBL3902681	C25H28F2N6O3	498.535	10 / 1	3.6	Yes
523352	CHEMBL3715672	C25H24F6N4O2	526.483	12 / 2	N/A	No
523359	CHEMBL3716474	C25H22Cl2F3N7O2	580.393	12 / 2	N/A	No
523385	CHEMBL3715372	C22H22F3N5O3S	493.505	12 / 2	N/A	No
517645	CHEMBL3979906	C23H30FN5O3S	475.583	8 / 1	2.3	Yes
523509	CHEMBL3715787	C22H21ClF4N6O3	528.893	13 / 2	N/A	No
523515	CHEMBL3718510	C24H24Cl2F3N5O2	542.384	10 / 2	N/A	No
523539	CHEMBL3715595	C23H22Cl3F3N6O2	577.814	11 / 2	N/A	No
523542	SCHEMBL7084798	C15H13N3OS2	315.409	3 / 2	2.8	Yes
523645	CHEMBL3717221	C25H23F5N6O2	534.491	13 / 2	N/A	No
523755	CHEMBL3718562	C22H21ClN6O2S	468.96	8 / 1	3.5	Yes
517704	CHEMBL3909497	C24H32F2N6O2	474.557	8 / 1	3.2	Yes
523819	CHEMBL3718978	C22H23ClF4N6O3	530.909	13 / 2	N/A	No
523835	CHEMBL3717660	C25H25F4N5O3S	551.561	13 / 2	N/A	No
523854	SCHEMBL7085534	C9H9N3O2S2	255.31	4 / 2	1.0	Yes
523855	CHEMBL3715955	C24H22ClF4N5O3	539.916	12 / 2	N/A	No
523875	CHEMBL3717828	C22H20BrF3N6O4S2	633.459	14 / 2	N/A	No
538023	CHEMBL3903382	C24H31F2N5O2	459.542	8 / 1	3.6	Yes
523938	CHEMBL3716522	C28H27ClF3N5O2	558.002	10 / 2	N/A	No
538045	CHEMBL3966731	C27H36F2N6O2	514.622	9 / 1	3.8	No
538094	CHEMBL3912899	C24H29F4N5O3	511.522	11 / 1	3.5	No
559916	SCHEMBL16818163	C24H29F4N5O3	511.522	11 / 1	3.5	No
517766	CHEMBL3973483	C23H29F2N5O2	445.515	8 / 1	3.2	Yes
524036	CHEMBL3718594	C22H21ClFN5O	425.892	7 / 1	4.0	Yes
524055	CHEMBL3717381	C23H24F4N6O4	524.477	14 / 2	N/A	No
517781	CHEMBL3943478	C25H32FN5O3	469.561	8 / 1	3.2	Yes
524153	CHEMBL3717950	C27H29F5N6O4	596.559	14 / 2	N/A	No
517815	CHEMBL3940900	C23H27F4N5O3	497.495	11 / 1	3.1	No
517819	CHEMBL3951645	C26H35FN6O3	498.603	8 / 1	3.2	Yes
517842	CHEMBL3931736	C22H25F4N5O2	467.469	10 / 1	3.2	Yes
517856	CHEMBL3938087	C23H29F2N5O2	445.515	8 / 1	3.2	Yes
524507	CHEMBL3716496	C24H27F4N5O4	525.505	13 / 2	N/A	No
524508	CHEMBL3718162	C8H8N4O2S2	256.298	5 / 2	0.4	Yes
524551	CHEMBL3718003	C22H25F3N6O3	478.476	12 / 2	N/A	No
524661	CHEMBL3717670	C21H21F4N5	419.428	9 / 1	4.7	Yes
524663	CHEMBL3715701	C23H23ClF3N5O3	509.914	11 / 2	N/A	No
524683	CHEMBL3717634	C25H25ClF3N5O3	535.952	10 / 2	N/A	No
538648	CHEMBL3935897	C23H28F3N5	431.507	8 / 1	3.9	Yes
560673	SCHEMBL16818235	C23H28F3N5	431.507	8 / 1	3.9	Yes
538649	CHEMBL3969026	C23H28F3N5	431.507	8 / 1	3.9	Yes
517892	CHEMBL3935030	C25H35FN6O3	486.592	8 / 1	3.1	Yes
524725	CHEMBL3718107	C24H28F4N6O3	524.521	13 / 2	N/A	No
524746	CHEMBL3715860	C22H25ClN6O	424.933	6 / 1	3.1	Yes
524747	CHEMBL3718345	C23H23F4N7O3	521.477	14 / 2	N/A	No
524772	CHEMBL3715254	C23H24F5N5O3	513.469	13 / 2	N/A	No
538756	CHEMBL3890613	C23H28F3N5O	447.506	8 / 1	3.6	Yes