TM-align Server

TM-align Results

 
 **************************************************************************
 *                        TM-align (Version 20140601)                     *
 * An algorithm for protein structure alignment and comparison            *
 * Based on statistics:                                                   *
 *       0.0 < TM-score < 0.30, random structural similarity              *
 *       0.5 < TM-score < 1.00, in about the same fold                    *
 * Reference: Y Zhang and J Skolnick, Nucl Acids Res 33, 2302-9 (2005)    *
 * Please email your comments and suggestions to: zhng@umich.edu          *
 **************************************************************************

Name of Chain_1: A873772                                           
Name of Chain_2: B873772                                           
Length of Chain_1:  154 residues
Length of Chain_2:  146 residues

Aligned length=  143, RMSD=   1.83, Seq_ID=n_identical/n_aligned= 0.245
TM-score= 0.81453 (if normalized by length of Chain_1)
TM-score= 0.85377 (if normalized by length of Chain_2)
(You should use TM-score normalized by length of the reference protein)

(":" denotes aligned residue pairs of d < 5.0 A, "." denotes other aligned residues)
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK--G-HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
 :::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::  : :::::::::::::: :::::::::::::::::::::::::  :::::::::::::::::::::: :     ::
-SLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKS-VADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKA-A-----GA

Visualization (Protein-1 in blue and Protein-2 in red)

Superposition of two proteins

Superposition of two proteins with ligands and solvents (when available)

Document downloads

Click A873772.pdb to download the first structure (structure1.pdb) that you submitted.
Click B873772.pdb to download the second structure (structure2.pdb) that you submitted.
Click C873772.pdb to download a Rasmol script file to show the superposed Ca-traces in the aligned regions (To view the structure superposition, please run 'rasmol -script C873772').
Click D873772.pdb to download a Rasmol script file to show the superposed Ca-traces of entire chain (To view the structure superposition, please run 'rasmol -script D873772').
Click E873772.pdb to download a Rasmol script file to show the superposed full-atom structure in the aligned region (To view the structure superposition, please run 'rasmol -script E873772').
Click F873772.pdb to download a Rasmol script file to show the superposed full-atom structure of the entire chain (To view the structure superposition, please run 'rasmol -script F873772').
Click G873772.pdb to download a Rasmol script file to show the superposed full-atom structure of the entire chain with ligands/solvents (To view the structure superposition, please run 'rasmol -script G873772').
All above files will be removed from the server after one month.

Reference:

Back to TM-align Homepage