Dear Administrator,
I've currently got a problem with the pair3.dat file and Illegal division by zero. I've attached my STDOUT output from running I-TASSER (v5.1) belwo. I've also attached a .tar.gz file containing the temporary files generated by I-TASSER. Would you please let me know what I could do to fix this problem please? Thank you in advance.
Your setting for running I-TASSER is:
-pkgdir = /home/z3371724/Tara/I-TASSER/I-TASSER5.1
-libdir = /srv/scratch/z3371724/I-TASSER
-java_home = /apps/java/8u45/
-seqname = example2
-datadir = /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2
-outdir = /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2
-runstyle = gnuparallel
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 143 residues:
> example2
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLA
LQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVP
AHKGIGGNEQVDKLVSAGIRKVL
2.1 run Psi-blast
2.2 Predict secondary structure with PSSpred...
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 Use all templates
submit threading jobs first and run pair during threading
3.1 do threading
start gnuparallel threading PPAS
start gnuparallel threading dPPAS
start gnuparallel threading dPPAS2
start gnuparallel threading Env-PPAS
start gnuparallel threading MUSTER
start gnuparallel threading wPPAS
start gnuparallel threading wdPPAS
start gnuparallel threading wMUSTER
Illegal division by zero at /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2/PPAS_example2 line 354.
Illegal division by zero at /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2/dPPAS_example2 line 356.
Illegal division by zero at /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2/dPPAS2_example2 line 355.
Illegal division by zero at /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2/Env-PPAS_example2 line 352.
At line 522 of file zal33.f
Fortran runtime error: End of file
Illegal division by zero at /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2/MUSTER_example2 line 599.
Picked up JAVA_TOOL_OPTIONS: -Xmx1g
sh: line 1: 152695 Killed /apps/java/8u45//bin/java -Xms2512m -Xmx2512m -jar fNNNd.jar > rst.dat
Illegal division by zero at /home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2/wPPAS_example2 line 340.
/home/z3371724/Tara/I-TASSER/I-TASSER5.1/example2/runpair.sh: line 4: 146319 Killed ./pair /srv/scratch/z3371724/I-TASSER/
cp: cannot stat ‘pair.3’: No such file or directory
cp: cannot stat ‘pair.1’: No such file or directory
only 0 threading programs have output, please check threading programs
Kind Regards,
Ignatius