MY Objective: Predict the Binding sites or is the number “one” in the binary sequence?
Each protein has three characteristics was obtained from the BioLip :
Protein name, Alphabetical sequence and Binary sequence
How do I find out that the letter R In alphabetical sequence that
Is equivalent to the number one in the binary sequence?
In BIOLIP ,there are 2 ways
Solution one is:
>1avpA
SANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKI
00000000000001100000000000000000010000000000000000000011100000000001100000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000001000000000000000000010100000000000000001111000000000011101000000000000001011000000000000
The amino acid R is in position 14
Solution two is: this Solution is kind of benchmark
>1avpA
R22 E23 R42 H63 Y64 T65 I76 A77 G98 R175 R195 R197 L214 H215 Y216 R217 I228 P229 E230 K232 K247 D249 G250
The amino acid R is in position 22
1-Please explain this difference ?
2-What is the relationship of the number one in a binary sequence with the corresponding amino acid in the alphabetical sequence, so How can I find that the amino acid R in the alphabetical sequence is equivalent to the number one in the binary sequence?