Is that serious?
Attaching full output:
Your setting for running I-TASSER is:
-pkgdir = /opt/itasser
-libdir = /db/ITLIB
-java_home = /usr
-seqname = cterm
-datadir = /home/user/Projekty/pa2504/cterm
-outdir = /home/user/Projekty/pa2504/cterm
-runstyle = serial
-homoflag = real
-idcut = 1
-ntemp = 20
-nmodel = 5
-light = false
-hours = 50
-LBS = false
-EC = false
-GO = false
1. make seq.txt and rmsinp
Your protein contains 95 residues:
> cterm
YARRCFVTRRVIDEGKAVGYLYREAPEEENDSGWRLMAGDESDDYMNTAGTTAYVSLGSV
LNADDSILPLLDAPPGRAFERLADGSFIEVQGPEG
2.1 run Psi-blast
2.2 Predict secondary structure with PSSpred...
2.3 Predict solvent accessibility...
2.4 run pairmod
2.4.1 Use all templates
2.4.2 running pair ................
30000 6379375 total lib str & residues
number of observations 16.97411 459573.9
pair done
3.1 do threading
start serial threading PPAS
/tmp/user/ITcterm
/home/user/Projekty/pa2504/cterm/PPAS_cterm
hostname: lelezor
starting time: pon, 20 sty 2020, 15:51:50 CET
pwd: /tmp/user/ITcterm
running zalign .....
ending time: pon, 20 sty 2020, 15:54:24 CET
start serial threading dPPAS
/tmp/user/ITcterm
/home/user/Projekty/pa2504/cterm/dPPAS_cterm
hostname: lelezor
starting time: pon, 20 sty 2020, 15:54:25 CET
pwd: /tmp/user/ITcterm
running zalign .....
ending time: pon, 20 sty 2020, 15:59:26 CET
start serial threading dPPAS2
/tmp/user/ITcterm
/home/user/Projekty/pa2504/cterm/dPPAS2_cterm
(END)At line 447 of file ppa1.f
Fortran runtime error: Bad real number in item 4 of list input